Recombinant Human LRRC3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9BY71

Gene Name: LRRC3

Expression System: Escherichia coli

Molecular Weight: 31.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 84%

Start Site: Asp41

End Site: His200

Coverage: 0.76

Isoelectric Point: 6

Core Sequence: DHAGAVAVFCSLRGLQEVPEDIPANTVLLKLDANKISHLPDGAFQHLHRLRELDLSHNAIEAIGSATFAGLAGGLRLLDLSYNRIQRIPKDALGKLSAKIRLSHNPLHCECALQEALWELKLDPDSVDEIACHTSVQEEFVGKPLVQALDAGASLCSVPH

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 84%, Rat - 84%, Pig - 85%, Cynomolgus monkey - 98%

Alternative gene names: C21orf102; LRRC3A

Alternative protein names: Leucine-rich repeat-containing protein 3

Protein name: leucine rich repeat containing 3

Full length: 257 amino acids

Entry name: LRRC3_HUMAN

• Artikelnummer: ASBPP-3068-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3068-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 81543