Recombinant Human MCOLN2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8IZK6

Gene Name: MCOLN2

Expression System: Escherichia coli

Molecular Weight: 20.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 72%

Start Site: Ile131

End Site: Phe280

Coverage: 0.29

Isoelectric Point: 6

Core Sequence: IFFAINQYHQLKDITLGTLGYGENEDNRIGLKVCKQHYKKGTMFPSNETLNIDNDVELDCVQLDLQDLSKKPPDWKNSSFFRLEFYRLLQVEISFHLKGIDLQTIHSRELPDCYVFQNTIIFDNKAHSGKIKIYFDSDAKIEECKDLNIF

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 72%, Pig - 83%, Cynomolgus monkey - 97%

Alternative gene names: /

Alternative protein names: Mucolipin-2; Transient receptor potential channel mucolipin 2; TRPML2

Protein name: mucolipin TRP cation channel 2

Full length: 566 amino acids

Entry name: MCLN2_HUMAN

• Artikelnummer: ASBPP-3147-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3147-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 255231