Recombinant Human MED26 Protein

Recombinant Human MED26 Protein
Artikelnummer
ASBPP-3130-100
Verpackungseinheit
100 μg
Hersteller
Absea Biotechnology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Note: Dry Ice fees will be extra-charged

Uniprot: O95402

Gene Name: MED26

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 79%

Start Site: Leu351

End Site: Asp460

Coverage: 0.21

Isoelectric Point: 10

Core Sequence: LAGPGCKAGLSPAEPLLSRAGFSPDSSKADSDAASSGGSDSKKKKRYRPRDYTVNLDGQVAEAGVKPVRLKERKLTFDPMTRQIKPLTQKEPVRADSPVHMEQQSRTELD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 79%, Pig - 93%, Cynomolgus monkey - 100%

Alternative gene names: ARC70; CRSP7

Alternative protein names: Mediator of RNA polymerase II transcription subunit 26; Activator-recruited cofactor 70 kDa component; ARC70; Cofactor required for Sp1 transcriptional activation subunit 7; CRSP complex subunit 7; Mediator complex subunit 26; Transcriptional coactivator CRSP70

Protein name: mediator complex subunit 26

Full length: 600 amino acids

Entry name: MED26_HUMAN
Mehr Informationen
Artikelnummer ASBPP-3130-100
Hersteller Absea Biotechnology
Hersteller Artikelnummer PP-3130-100
Verpackungseinheit 100 μg
Mengeneinheit STK
Human Gene ID 9441
Produktinformation (PDF)
×
MSDS (PDF)
×