Recombinant Human MIF Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P14174

Gene Name: MIF

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 89%

Start Site: Pro2

End Site: Ala115

Coverage: 1.00

Isoelectric Point: 7.5

Core Sequence: PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 89%, Rat - 90%, Pig - 95%, Cynomolgus monkey - 100%

Alternative gene names: GLIF; MMIF

Alternative protein names: Macrophage migration inhibitory factor; MIF; Glycosylation-inhibiting factor; GIF; L-dopachrome isomerase; L-dopachrome tautomerase; Phenylpyruvate tautomerase

Protein name: macrophage migration inhibitory factor

Full length: 115 amino acids

Entry name: MIF_HUMAN

Product panel: Cytokines,Enzyme

• Artikelnummer: ASBPP-3268-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3268-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 4282