Recombinant Human MMP13 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P45452

Gene Name: MMP13

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 82%

Start Site: Asp361

End Site: Lys430

Coverage: 0.22

Isoelectric Point: 6

Core Sequence: DILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 82%, Rat - 85%, Pig - 89%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: Collagenase 3; Matrix metalloproteinase-13; MMP-13

Protein name: matrix metallopeptidase 13

Full length: 471 amino acids

Entry name: MMP13_HUMAN

Product panel: Enzyme

• Artikelnummer: ASBPP-295-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-295-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 4322