Recombinant Human MPHOSPH10 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O00566

Gene Name: MPHOSPH10

Expression System: Escherichia coli

Molecular Weight: 50 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 85%

Start Site: Asp241

End Site: Asp660

Coverage: 0.62

Isoelectric Point: 5

Core Sequence: DSDEDEGGLFGSKKLKSGKSSRNLKYKDFFDPVESDEDITNVHDDELDSNKEDDEIAEEEAEELSISETDEDDDLQENEDNKQHKESLKRVTFALPDDAETEDTGVLNVKKNSDEVKSSFEKRQEKMNEKIASLEKELLEKKPWQLQGEVTAQKRPENSLLEETLHFDHAVRMAPVITEETTLQLEDIIKQRIRDQAWDDVVRKEKPKEDAYEYKKRLTLDHEKSKLSLAEIYEQEYIKLNQQKTAEEENPEHVEIQKMMDSLFLKLDALSNFHFIPKPPVPEIKVVSNLPAITMEEVAPVSVSDAALLAPEEIKEKNKAGDIKTAAEKTATDKKRERRKKKYQKRMKIKEKEKRRKLLEKSSVDQAGKYSKTVASEKLKQLTKTGKASFIKDEGKDKALKSSQAFFSKLQDQVKMQIND

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 85%, Pig - 89%, Cynomolgus monkey - 98%

Alternative gene names: MPP10

Alternative protein names: U3 small nucleolar ribonucleoprotein protein MPP10; M phase phosphoprotein 10

Protein name: M-phase phosphoprotein 10

Full length: 681 amino acids

Entry name: MPP10_HUMAN

• Artikelnummer: ASBPP-10418-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-10418-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 10199