Recombinant Human MTA2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O94776

Gene Name: MTA2

Expression System: Escherichia coli

Molecular Weight: 26.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Cys151

End Site: Gly360

Coverage: 0.33

Isoelectric Point: 6.5

Core Sequence: CKYQAEIPDRLVEGESDNRNQQKMEMKVWDPDNPLTDRQIDQFLVVARAVGTFARALDCSSSIRQPSLHMSAAAASRDITLFHAMDTLQRNGYDLAKAMSTLVPQGGPVLCRDEMEEWSASEAMLFEEALEKYGKDFNDIRQDFLPWKSLASIVQFYYMWKTTDRYIQQKRLKAAEADSKLKQVYIPTYTKPNPNQIISVGSKPGMNGAG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 75%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: MTA1L1; PID

Alternative protein names: Metastasis-associated protein MTA2; Metastasis-associated 1-like 1; MTA1-L1 protein; p53 target protein in deacetylase complex

Protein name: metastasis associated 1 family member 2

Full length: 668 amino acids

Entry name: MTA2_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-3115-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3115-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 9219