Recombinant Human MUSTN1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8IVN3

Gene Name: MUSTN1

Expression System: Escherichia coli

Molecular Weight: 10 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 84%

Start Site: Ile11

End Site: Val80

Coverage: 0.98

Isoelectric Point: 10.5

Core Sequence: IKKKRPPVKDEDLKGARGNLTKNQEIKSKTYQVMRECEQAGSAAPSVFSRTRTGTETVFEKPKAGPTKSV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 84%, Rat - 85%, Pig - 89%, Cynomolgus monkey - 98%

Alternative gene names: /

Alternative protein names: Musculoskeletal embryonic nuclear protein 1

Protein name: musculoskeletal, embryonic nuclear protein 1

Full length: 82 amino acids

Entry name: MSTN1_HUMAN

• Artikelnummer: ASBPP-3139-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3139-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 389125