Recombinant Human NEPRO Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q6NW34

Gene Name: NEPRO

Expression System: Escherichia coli

Molecular Weight: 12.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 57%

Start Site: Glu271

End Site: Gly350

Coverage: 0.17

Isoelectric Point: 10.5

Core Sequence: ETLLGISKKAKQMKINVQNNVDLGQPVKNKRVFKEESSEFDVRAFCNQLKHKATQETSFDFKCSQSRLKTTKYSSQKVIG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 57%, Pig - 78%, Cynomolgus monkey - 92%

Alternative gene names: C3orf17

Alternative protein names: Nucleolus and neural progenitor protein

Protein name: nucleolus and neural progenitor protein

Full length: 567 amino acids

Entry name: NEPRO_HUMAN

• Artikelnummer: ASBPP-3281-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3281-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 25871