Recombinant Human NINJ2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NZG7

Gene Name: NINJ2

Expression System: Escherichia coli

Molecular Weight: 8.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 71%

Start Site: Gln11

End Site: Ser60

Coverage: 0.45

Isoelectric Point: 7

Core Sequence: QPGSSDPRSQPINLNHYATKKSVAESMLDVALFMSNAMRLKAVLEQGPSS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 71%, Rat - 76%, Pig - 58%, Cynomolgus monkey - 94%

Alternative gene names: /

Alternative protein names: Ninjurin-2; Nerve injury-induced protein 2

Protein name: ninjurin 2

Full length: 142 amino acids

Entry name: NINJ2_HUMAN

• Artikelnummer: ASBPP-3127-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3127-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 4815