Recombinant Human NKX6-1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P78426

Gene Name: NKX6-1

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 97%

Start Site: Tyr271

End Site: Ser350

Coverage: 0.25

Isoelectric Point: 9

Core Sequence: YSLGMTESQVKVWFQNRRTKWRKKHAAEMATAKKKQDSETERLKGASENEEEDDDYNKPLDPNSDDEKITQLLKKHKSSS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Rat - 97%, Pig - 99%, Cynomolgus monkey - 98%

Alternative gene names: NKX6A

Alternative protein names: Homeobox protein Nkx-6.1; Homeobox protein NK-6 homolog A

Protein name: NK6 homeobox 1

Full length: 367 amino acids

Entry name: NKX61_HUMAN

Product panel: Neuroscience Biomarkers,DNA binding & Chromatin

• Artikelnummer: ASBPP-3246-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3246-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 4825