Recombinant Human NOTO Protein

Note: Dry Ice fees will be extra-charged

Uniprot: A8MTQ0

Gene Name: NOTO

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 83%

Start Site: Pro141

End Site: Lys210

Coverage: 0.32

Isoelectric Point: 11

Core Sequence: PDWAPTEDLQDTERQQKRVRTMFNLEQLEELEKVFAKQHNLVGKKRAQLAARLKLTENQVRVWFQNRRVK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 83%, Rat - 50%, Pig - 88%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: Homeobox protein notochord

Protein name: notochord homeobox

Full length: 251 amino acids

Entry name: NOTO_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-3273-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3273-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 344022