Recombinant Human NPEPPS Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P55786

Gene Name: NPEPPS

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Leu71

End Site: Gly150

Coverage: 0.09

Isoelectric Point: 4.5

Core Sequence: LLDFTFEGKLEAAAQVRQATNQIVMNCADIDIITASYAPEGDEEIHATGFNYQNEDEKVTLSFPSTLQTGTGTLKIDFVG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Pig - 98%, Cynomolgus monkey - 100%

Alternative gene names: PSA

Alternative protein names: Puromycin-sensitive aminopeptidase; PSA; Cytosol alanyl aminopeptidase; AAP-S

Protein name: aminopeptidase puromycin sensitive

Full length: 919 amino acids

Entry name: PSA_HUMAN

Product panel: Enzyme

• Artikelnummer: ASBPP-316-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-316-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 9520