Recombinant Human NPM3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O75607

Gene Name: NPM3

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 82%

Start Site: Glu61

End Site: Pro170

Coverage: 0.64

Isoelectric Point: 4.5

Core Sequence: EHVLALTMLCLTEGAKDECNVVEVVARNHDHQEIAVPVANLKLSCQPMLSLDDFQLQPPVTFRLKSGSGPVRITGRHQIVTMSNDVSEEESEEEEEDSDEEEVELCPILP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 82%, Rat - 49%, Pig - 93%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: Nucleoplasmin-3

Protein name: nucleophosmin/nucleoplasmin 3

Full length: 178 amino acids

Entry name: NPM3_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-3116-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3116-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 10360