Note: Dry Ice fees will be extra-charged
Uniprot: Q9H7Z3
Gene Name: NRDE2
Expression System: Escherichia coli
Molecular Weight: 13.5 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 68%
Start Site: Pro121
End Site: Val220
Coverage: 0.09
Isoelectric Point: 8.5
Core Sequence: PSRGVGGSKKESEEPNQGNNAAADTGHRFVWLEDIQAVTGETFRTDKKPDPANWEYKSLYRGDIARYKRKGDSCLGINPKKQCISWEGTSTEKKHSRKQV
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 68%, Pig - 85%, Cynomolgus monkey - 97%
Alternative gene names: C14orf102
Alternative protein names: Nuclear exosome regulator NRDE2; Protein NRDE2 homolog
Protein name: NRDE-2, necessary for RNA interference, domain containing
Full length: 1164 amino acids
Entry name: NRDE2_HUMAN
Product panel: DNA binding & Chromatin
Deutsch
English
