Recombinant Human NRGN Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q92686

Gene Name: NRGN

Expression System: Escherichia coli

Molecular Weight: 8.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 96%

Start Site: Met1

End Site: Asp78

Coverage: 1.00

Isoelectric Point: 11

Core Sequence: MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGGAGGGPSGD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 96%, Rat - 96%, Pig - 96%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: Neurogranin; Ng; RC3) [Cleaved into: NEUG(55-78]

Protein name: neurogranin

Full length: 78 amino acids

Entry name: NEUG_HUMAN

Product panel: Neuroscience Biomarkers

• Artikelnummer: ASBPP-3327-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3327-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 4900