Recombinant Human OTOR Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NRC9

Gene Name: OTOR

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 90%

Start Site: Val18

End Site: Glu128

Coverage: 1.00

Isoelectric Point: 5.5

Core Sequence: VHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYSKLVKENGAGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPTTDIDFFCE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 90%, Rat - 44%, Pig - 88%, Cynomolgus monkey - 97%

Alternative gene names: FDP; MIAL

Alternative protein names: Otoraplin; Fibrocyte-derived protein; Melanoma inhibitory activity-like protein

Protein name: otoraplin

Full length: 128 amino acids

Entry name: OTOR_HUMAN

• Artikelnummer: ASBPP-3527-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3527-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 56914