Recombinant Human OTP Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q5XKR4

Gene Name: OTP

Expression System: Escherichia coli

Molecular Weight: 19 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Arg11

End Site: Lys160

Coverage: 0.50

Isoelectric Point: 10

Core Sequence: RLGMKDAAELLGHREAVKCRLGVGGSDPGGHPGDLAPNSDPVEGATLLPGEDITTVGSTPASLAVSAKDPDKQPGPQGGPNPSQAGQQQGQQKQKRHRTRFTPAQLNELERSFAKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 72%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Homeobox protein orthopedia

Protein name: orthopedia homeobox

Full length: 325 amino acids

Entry name: OTP_HUMAN

Product panel: Neuroscience Biomarkers,DNA binding & Chromatin

• Artikelnummer: ASBPP-3537-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3537-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 23440