Recombinant Human PCDHB5 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y5E4

Gene Name: PCDHB5

Expression System: Escherichia coli

Molecular Weight: 23.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 80%

Start Site: Val251

End Site: Phe450

Coverage: 0.27

Isoelectric Point: 4.5

Core Sequence: VPENSPLNSLVVVVSARDLDAGAYGSVAYALFQGDEVTQPFVIDEKTAEIRLKRALDFEATPYYNVEIVATDGGGLSGKCTVAIEVVDVNDNAPELTMSTLSSPTPENAPETVVAVFSVSDPDSGDNGRMICSIQNDLPFLLKPTLKNFYTLVTQRTLDRESQAEYNITITVTDMGTPRLKTEHNITVLVSDVNDNAPAF

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 80%, Rat - 72%, Pig - 83%, Cynomolgus monkey - 72%

Alternative gene names: /

Alternative protein names: Protocadherin beta-5; PCDH-beta-5

Protein name: protocadherin beta 5

Full length: 795 amino acids

Entry name: PCDB5_HUMAN

• Artikelnummer: ASBPP-2973-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-2973-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 26167