Recombinant Human PCDHB6 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y5E3

Gene Name: PCDHB6

Expression System: Escherichia coli

Molecular Weight: 24.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 70%

Start Site: Pro251

End Site: Thr450

Coverage: 0.27

Isoelectric Point: 4

Core Sequence: PENNPLGSLVITVSARDLDAGSFGKVSYALFQVDDVNQPFEINAITGEIRLRKALDFEEIQSYDVDVEATDGGGLSGKCSLVVRVLDVNDNAPELTMSFFISLIPENLPEITVAVFSVSDADSGHNQQVICSIENNLPFLLRPSVENFYTLVTEGALDRESRAEYNITITVTDLGTPRLKTQQSITVQVSDVNDNVPAFT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 70%, Rat - 69%, Pig - 82%, Cynomolgus monkey - 96%

Alternative gene names: /

Alternative protein names: Protocadherin beta-6; PCDH-beta-6

Protein name: protocadherin beta 6

Full length: 794 amino acids

Entry name: PCDB6_HUMAN

• Artikelnummer: ASBPP-2972-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-2972-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 56130