Recombinant Human PCDHGC5 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y5F6

Gene Name: PCDHGC5

Expression System: Escherichia coli

Molecular Weight: 17.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Leu801

End Site: Lys940

Coverage: 0.16

Isoelectric Point: 10

Core Sequence: LALEPDAIRSRSNTLRERSQQAPPNTDWRFSQAQRPGTSGSQNGDDTGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAGTMGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Pig - 71%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Protocadherin gamma-C5; PCDH-gamma-C5

Protein name: protocadherin gamma subfamily C, 5

Full length: 944 amino acids

Entry name: PCDGM_HUMAN

• Artikelnummer: ASBPP-2978-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-2978-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 56097