Recombinant Human PCGF6 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9BYE7

Gene Name: PCGF6

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 82%

Start Site: Ala21

End Site: Pro130

Coverage: 0.33

Isoelectric Point: 4

Core Sequence: AALPPPPPVSPPALTPAPAAGEEGPAPLSETGAPGCSGSRPPELEPERSLGRFRGRFEDEDEELEEEEELEEEEEEEEEDMSHFSLRLEGGRQDSEDEEERLINLSELTP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 82%, Rat - 83%, Pig - 82%, Cynomolgus monkey - 97%

Alternative gene names: MBLR; RNF134

Alternative protein names: Polycomb group RING finger protein 6; Mel18 and Bmi1-like RING finger; RING finger protein 134

Protein name: polycomb group ring finger 6

Full length: 350 amino acids

Entry name: PCGF6_HUMAN

Product panel: E3 Ligase,DNA binding & Chromatin

• Artikelnummer: ASBPP-10405-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-10405-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 84108