Recombinant Human PITX3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O75364

Gene Name: PITX3

Expression System: Escherichia coli

Molecular Weight: 10 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Ala21

End Site: Ser90

Coverage: 0.26

Isoelectric Point: 8

Core Sequence: AGTPHPQLPEHGCKGQEHSDSEKASASLPGGSPEDGSLKKKQRRQRTHFTSQQLQELEATFQRNRYPDMS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 99%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: PTX3

Alternative protein names: Pituitary homeobox 3; Homeobox protein PITX3; Paired-like homeodomain transcription factor 3

Protein name: paired like homeodomain 3

Full length: 302 amino acids

Entry name: PITX3_HUMAN

Product panel: Neuroscience Biomarkers,DNA binding & Chromatin

• Artikelnummer: ASBPP-035-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-035-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 5309