Recombinant Human PRKRIP1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9H875

Gene Name: PRKRIP1

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 90%

Start Site: Glu101

End Site: Phe180

Coverage: 0.48

Isoelectric Point: 10

Core Sequence: EKQKLDAEFQKRLEKNKIAAEEQTAKRRKKRQKLKEKKLLAKKMKLEQKKQEGPGQPKEQGSSSSAEASGTEEEEEVPSF

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 90%, Pig - 98%

Alternative gene names: /

Alternative protein names: PRKR-interacting protein 1

Protein name: PRKR interacting protein 1

Full length: 184 amino acids

Entry name: PKRI1_HUMAN

• Artikelnummer: ASBPP-3297-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3297-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 79706