Recombinant Human PRTN3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P24158

Gene Name: PRTN3

Expression System: Escherichia coli

Molecular Weight: 37 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 68%

Start Site: Ala26

End Site: Arg249

Coverage: 1.00

Isoelectric Point: 7

Core Sequence: AEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYVDWIRSTLRR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 68%, Rat - 39%, Pig - 73%, Cynomolgus monkey - 46%

Alternative gene names: MBN

Alternative protein names: Myeloblastin; AGP7; C-ANCA antigen; Leukocyte proteinase 3; PR-3; PR3; Neutrophil proteinase 4; NP-4; P29; Wegener autoantigen

Protein name: proteinase 3

Full length: 256 amino acids

Entry name: PRTN3_HUMAN

Product panel: Autoimmune Disease,Enzyme

• Artikelnummer: ASBPP-3260-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3260-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 5657