Recombinant Human R3HDM2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y2K5

Gene Name: R3HDM2

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 92%

Start Site: Leu11

End Site: Asp110

Coverage: 0.11

Isoelectric Point: 7.5

Core Sequence: LEIMKESEKKLVEESVNKNKFISKTPSKEEIEKECEDTSLRQETQRRTSNHGHARKRAKSNSKLKLVRSLAVCEESSTPFADGPLETQDIIQLHISCPSD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 92%, Pig - 97%, Cynomolgus monkey - 100%

Alternative gene names: KIAA1002

Alternative protein names: R3H domain-containing protein 2

Protein name: R3H domain containing 2

Full length: 976 amino acids

Entry name: R3HD2_HUMAN

• Artikelnummer: ASBPP-3655-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3655-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 22864