Recombinant Human RBIS Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8N0T1

Gene Name: RBIS

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 77%

Start Site: Ser11

End Site: Val90

Coverage: 0.94

Isoelectric Point: 11

Core Sequence: SRNVFHIASQKNFKAKNKAKPVTTNLKKINIMNEEKVNRVNKAFVNVQKELAHFAKSISLEPLQKELIPQQRHESKPVNV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 77%, Pig - 82%, Cynomolgus monkey - 94%

Alternative gene names: C8orf59

Alternative protein names: Ribosomal biogenesis factor

Protein name: ribosomal biogenesis factor

Full length: 100 amino acids

Entry name: RBIS_HUMAN

• Artikelnummer: ASBPP-3025-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3025-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 401466