Recombinant Human RBM11 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P57052

Gene Name: RBM11

Expression System: Escherichia coli

Molecular Weight: 17 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 45%

Start Site: Pro151

End Site: Gln270

Coverage: 0.49

Isoelectric Point: 9

Core Sequence: PVLQLPYYEMTAPLPNSASVSSSLNHVPDLEAGPSSYKWTHQQPSDSDLYQMTAPLPNSASVSSSLNHVPDLEAGPSSYKWTHQQPSDSDLYQMNKRKRQKQTSDSDSSTDNNRGNECSQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 45%, Pig - 58%, Cynomolgus monkey - 96%

Alternative gene names: /

Alternative protein names: Splicing regulator RBM11; RNA-binding motif protein 11

Protein name: RNA binding motif protein 11

Full length: 281 amino acids

Entry name: RBM11_HUMAN

• Artikelnummer: ASBPP-3653-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3653-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 54033