Recombinant Human RBM4B Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9BQ04

Gene Name: RBM4B

Expression System: Escherichia coli

Molecular Weight: 30.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Arg11

End Site: Thr260

Coverage: 0.72

Isoelectric Point: 7

Core Sequence: REATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDKTAAEDAIRNLHHYKLHGVNINVEASKNKSKASTKLHVGNISPTCTNQELRAKFEEYGPVIECDIVKDYAFVHMERAEDAVEAIRGLDNTEFQGKRMHVQLSTSRLRTAPGMGDQSGCYRCGKEGHWSKECPVDRTGRVADFTEQYNEQYGAVRTPYTMGYGESMYYNDAYGALDYYKRYRVRSYEAVAAAAAASAYNYAEQTMSHLPQVQSTTVT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 99%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: RBM30

Alternative protein names: RNA-binding protein 4B; RNA-binding motif protein 30; RNA-binding motif protein 4B; RNA-binding protein 30

Protein name: RNA binding motif protein 4B

Full length: 359 amino acids

Entry name: RBM4B_HUMAN

• Artikelnummer: ASBPP-3651-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3651-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 83759