Recombinant Human REEP2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9BRK0

Gene Name: REEP2

Expression System: Escherichia coli

Molecular Weight: 14.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 89%

Start Site: Lys101

End Site: Asp210

Coverage: 0.48

Isoelectric Point: 4.5

Core Sequence: KEIDEYITQARDKSYETMMRVGKRGLNLAANAAVTAAAKGVLSEKLRSFSMQDLTLIRDEDALPLQRPDGRLRPSPGSLLDTIEDLGDDPALSLRSSTNPADSRTEASED

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 89%, Rat - 51%, Pig - 92%, Cynomolgus monkey - 95%

Alternative gene names: C5orf19; SGC32445

Alternative protein names: Receptor expression-enhancing protein 2

Protein name: receptor accessory protein 2

Full length: 252 amino acids

Entry name: REEP2_HUMAN

• Artikelnummer: ASBPP-3336-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3336-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 51308