Recombinant Human RFC3 Protein

Recombinant Human RFC3 Protein
Artikelnummer
ASBPP-3418-100
Verpackungseinheit
100 μg
Hersteller
Absea Biotechnology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Note: Dry Ice fees will be extra-charged

Uniprot: P40938

Gene Name: RFC3

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: His71

End Site: Leu140

Coverage: 0.22

Isoelectric Point: 7

Core Sequence: HQTITTPSKKKIEISTIASNYHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETNSQRDFKVVLLTEVDKL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Replication factor C subunit 3; Activator 1 38 kDa subunit; A1 38 kDa subunit; Activator 1 subunit 3; Replication factor C 38 kDa subunit; RF-C 38 kDa subunit; RFC38

Protein name: replication factor C subunit 3

Full length: 356 amino acids

Entry name: RFC3_HUMAN

Product panel: DNA binding & Chromatin
Mehr Informationen
Artikelnummer ASBPP-3418-100
Hersteller Absea Biotechnology
Hersteller Artikelnummer PP-3418-100
Verpackungseinheit 100 μg
Mengeneinheit STK
Human Gene ID 5983
Produktinformation (PDF)
×
MSDS (PDF)
×