Recombinant Human RHBDD3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y3P4

Gene Name: RHBDD3

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 70%

Start Site: Arg261

End Site: Ser380

Coverage: 0.34

Isoelectric Point: 5

Core Sequence: RPVQPTWEGSSEAGLDWAGASFSPGTPMWAALDEQMLQEGIQASLLDGPAQEPQSAPWLSKSSVSSLRLQQLERMGFPTEQAVVALAATGRVEGAVSLLVGGQVGTETLVTHGKGGPAHS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 70%, Rat - 70%, Pig - 83%, Cynomolgus monkey - 96%

Alternative gene names: C22orf3

Alternative protein names: Rhomboid domain-containing protein 3

Protein name: rhomboid domain containing 3

Full length: 386 amino acids

Entry name: RHBD3_HUMAN

• Artikelnummer: ASBPP-3659-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3659-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 25807