Recombinant Human RPP38 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P78345

Gene Name: RPP38

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 65%

Start Site: Met41

End Site: Val120

Coverage: 0.31

Isoelectric Point: 10

Core Sequence: MHFILQTLEDRLKAIGLQKIEDKKKKNKTPFLKKESREKCSIAVDISENLKEKKTDAKQQVSGWTPAHVRKQLAIGVNEV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 65%, Pig - 66%, Cynomolgus monkey - 94%

Alternative gene names: /

Alternative protein names: Ribonuclease P protein subunit p38; RNaseP protein p38

Protein name: ribonuclease P/MRP subunit p38

Full length: 283 amino acids

Entry name: RPP38_HUMAN

• Artikelnummer: ASBPP-349-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-349-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 10557