Recombinant Human SCAMP1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O15126

Gene Name: SCAMP1

Expression System: Escherichia coli

Molecular Weight: 18.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Asp11

End Site: Lys150

Coverage: 0.45

Isoelectric Point: 6

Core Sequence: DPDLNNPFKDPSVTQVTRNVPPGLDEYNPFSDSRTPPPGGVKMPNVPNTQPAIMKPTEEHPAYTQIAKEHALAQAELLKRQEELERKAAELDRREREMQNLSQHGRKNNWPPLPSNFPVGPCFYQDFSVDIPVEFQKTVK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 99%

Alternative gene names: SCAMP

Alternative protein names: Secretory carrier-associated membrane protein 1; Secretory carrier membrane protein 1

Protein name: secretory carrier membrane protein 1

Full length: 338 amino acids

Entry name: SCAM1_HUMAN

• Artikelnummer: ASBPP-3313-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3313-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 9522