Recombinant Human SCML1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9UN30

Gene Name: SCML1

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Val11

End Site: Gln90

Coverage: 0.27

Isoelectric Point: 5.5

Core Sequence: VIKTRIPTYDEDDNTILYAYETKPEFVNKEPNIVSDASCNTEEQLKTVDDVLIHCQVIYDALQNLDKKIDVIRRKVSKIQ

Homologies: Highest protein sequence identity to the following orthologs: Pig - 64%, Cynomolgus monkey - 91%

Alternative gene names: /

Alternative protein names: Sex comb on midleg-like protein 1

Protein name: Scm polycomb group protein like 1

Full length: 329 amino acids

Entry name: SCML1_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-3057-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3057-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 6322