Recombinant Human SELENOP Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P49908

Gene Name: SELENOP

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 61%

Start Site: Lys181

End Site: Pro290

Coverage: 0.34

Isoelectric Point: 7.5

Core Sequence: KDEDFCKRVSLATVDKTVETPSPHYHHEHHHNHGHQHLGSSELSENQQPGAPNAPTHPAPPGLHHHHKHKGQHRQGHPENRDMPASEDLQDLQKKLCRKRCINQLLCKLP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 61%, Rat - 60%, Pig - 62%

Alternative gene names: SELP; SEPP1

Alternative protein names: Selenoprotein P; SeP

Protein name: selenoprotein P

Full length: 381 amino acids

Entry name: SEPP1_HUMAN

• Artikelnummer: ASBPP-305-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-305-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 6414