Recombinant Human SETD7 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8WTS6

Gene Name: SETD7

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Ala11

End Site: Tyr110

Coverage: 0.30

Isoelectric Point: 4

Core Sequence: AVEGHLDDDGLPHGFCTVTYSSTDRFEGNFVHGEKNGRGKFFFFDGSTLEGYYVDDALQGQGVYTYEDGGVLQGTYVDGELNGPAQEYDTDGRLIFKGQY

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Rat - 31%, Pig - 99%

Alternative gene names: KIAA1717; KMT7; SET7; SET9

Alternative protein names: Histone-lysine N-methyltransferase SETD7; Histone H3-K4 methyltransferase SETD7; H3-K4-HMTase SETD7; Lysine N-methyltransferase 7; SET domain-containing protein 7; SET7/9

Protein name: SET domain containing 7, histone lysine methyltransferase

Full length: 366 amino acids

Entry name: SETD7_HUMAN

Product panel: DNA binding & Chromatin,Enzyme

• Artikelnummer: ASBPP-3292-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3292-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 80854