Recombinant Human SIRPG Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9P1W8

Gene Name: SIRPG

Expression System: Escherichia coli

Molecular Weight: 25 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 61%

Start Site: Glu31

End Site: Val130

Coverage: 0.30

Isoelectric Point: 6.5

Core Sequence: ELQMIQPEKLLLVTVGKTATLHCTVTSLLPVGPVLWFRGVGPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRISSITPADVGTYYCVKFRKGSPENV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 61%, Rat - 59%, Pig - 66%, Cynomolgus monkey - 95%

Alternative gene names: SIRPB2

Alternative protein names: Signal-regulatory protein gamma; SIRP-gamma; CD172 antigen-like family member B; Signal-regulatory protein beta-2; SIRP-b2; SIRP-beta-2; CD antigen CD172g

Protein name: signal regulatory protein gamma

Full length: 387 amino acids

Entry name: SIRPG_HUMAN

CD Antigen: CD172g

Product panel: CD Antigen

• Artikelnummer: ASBPP-3278-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3278-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 55423