Recombinant Human SLC13A4 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9UKG4

Gene Name: SLC13A4

Expression System: Escherichia coli

Molecular Weight: 15.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 29%

Start Site: Thr141

End Site: His260

Coverage: 0.20

Isoelectric Point: 6.5

Core Sequence: TSTTAMVMPIVEAVLQELVSAEDEQLVAGNSNTEEAEPISLDVKNSQPSLELIFVNEESNADLTTLMHNENLNGVPSITNPIKTANQHQGKKQHPSQEKPQVLTPSPRKQKLNRKYRSHH

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 29%, Rat - 29%, Pig - 75%, Cynomolgus monkey - 95%

Alternative gene names: SUT1

Alternative protein names: Solute carrier family 13 member 4; Na(+)/sulfate cotransporter SUT-1; NaS2

Protein name: solute carrier family 13 member 4

Full length: 626 amino acids

Entry name: S13A4_HUMAN

• Artikelnummer: ASBPP-3368-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3368-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 26266