Recombinant Human SLC25A25 Protein

Recombinant Human SLC25A25 Protein
Artikelnummer
ASBPP-3064-100
Verpackungseinheit
100 μg
Hersteller
Absea Biotechnology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Note: Dry Ice fees will be extra-charged

Uniprot: Q6KCM7

Gene Name: SLC25A25

Expression System: Escherichia coli

Molecular Weight: 23.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Ile11

End Site: Glu180

Coverage: 0.40

Isoelectric Point: 6

Core Sequence: IGEAQTEFQYFESKGLPAELKSIFKLSVFIPSQEFSTYRQWKQKIVQAGDKDLDGQLDFEEFVHYLQDHEKKLRLVFKSLDKKNDGRIDAQEIMQSLRDLGVKISEQQAEKILKSMDKNGTMTIDWNEWRDYHLLHPVENIPEIILYWKHSTIFDVGENLTVPDEFTVEE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Rat - 98%, Pig - 98%, Cynomolgus monkey - 91%

Alternative gene names: APC3; KIAA1896; MCSC3; SCAMC2

Alternative protein names: Mitochondrial adenyl nucleotide antiporter SLC25A25; Mitochondrial ATP-Mg/Pi carrier protein 3; Mitochondrial Ca(2+)-dependent solute carrier protein 3; Short calcium-binding mitochondrial carrier protein 2; SCaMC-2; Solute carrier family 25 member 25

Protein name: solute carrier family 25 member 25

Full length: 469 amino acids

Entry name: SCMC2_HUMAN
Mehr Informationen
Artikelnummer ASBPP-3064-100
Hersteller Absea Biotechnology
Hersteller Artikelnummer PP-3064-100
Verpackungseinheit 100 μg
Mengeneinheit STK
Human Gene ID 114789
Produktinformation (PDF)
×
MSDS (PDF)
×