Recombinant Human SLC7A14 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8TBB6

Gene Name: SLC7A14

Expression System: Escherichia coli

Molecular Weight: 16.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 96%

Start Site: Tyr431

End Site: Ala560

Coverage: 0.17

Isoelectric Point: 6.5

Core Sequence: YQPESDIDGFVKFLSEEHTKKKEGILADCEKEACSPVSEGDEFSGPATNTCGAKNLPSLGDNEMLIGKSDKSTYNVNHPNYGTVDMTTGIEADESENIYLIKLKKLIGPHYYTMRIRLGLPGKMDRPTAA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 96%

Alternative gene names: KIAA1613

Alternative protein names: Solute carrier family 7 member 14; Gamma-aminobutyric acid transporter SLC7A14

Protein name: solute carrier family 7 member 14

Full length: 771 amino acids

Entry name: S7A14_HUMAN

• Artikelnummer: ASBPP-3321-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3321-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 57709