Recombinant Human SLX1A Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9BQ83

Gene Name: SLX1A,SLX1B

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 68%

Start Site: Leu151

End Site: Glu260

Coverage: 0.46

Isoelectric Point: 4

Core Sequence: LAFGPPPPQAPAPRRRAGPFDDAEPEPDQGDPGACCSLCAQTIQDEEGPLCCPHPGCLLRAHVICLAEEFLQEEPGQLLPLEGQCPCCEKSLLWGDLIWLCQMDTEKEVE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 68%, Rat - 68%

Alternative gene names: GIYD1; SLX1,GIYD2; SLX1

Alternative protein names: Structure-specific endonuclease subunit SLX1; GIY-YIG domain-containing protein 1

Protein name: SLX1 homolog A, structure-specific endonuclease subunit,SLX1 homolog B, structure-specific endonuclease subunit

Full length: 275 amino acids

Entry name: SLX1_HUMAN

Product panel: Enzyme

• Artikelnummer: ASBPP-3314-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3314-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 548593