Recombinant Human SMARCD3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q6STE5

Gene Name: SMARCD3

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Ile341

End Site: Asn440

Coverage: 0.22

Isoelectric Point: 4.5

Core Sequence: INHVISVDPSDQKKTACYDIDVEVEEPLKGQMSSFLLSTANQQEISALDSKIHETIESINQLKIQRDFMLSFSRDPKGYVQDLLRSQSRDLKVMTDVAGN

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 79%, Pig - 99%

Alternative gene names: BAF60C

Alternative protein names: SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3; 60 kDa BRG-1/Brm-associated factor subunit C; BRG1-associated factor 60C; BAF60C

Protein name: SWI/SNF related BAF chromatin remodeling complex subunit D3

Full length: 483 amino acids

Entry name: SMRD3_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-3286-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3286-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 6604