Recombinant Human SNAPC1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q16533

Gene Name: SNAPC1

Expression System: Escherichia coli

Molecular Weight: 21 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 68%

Start Site: Pro201

End Site: Thr360

Coverage: 0.47

Isoelectric Point: 10.5

Core Sequence: PDKALSLIKDDFFDNIKNIVLEHQQWHKDRKNPSLKSKTNDGEEKMEGNSQETERCERAESLAKIKSKAFSVVIQASKSRRHRQVKLDSSDSDSASGQGQVKATRKKEKKERLKPAGRKMSLRNKGNVQNIHKEDKPLSLSMPVITEEEENESLSGTEFT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 68%, Pig - 82%, Cynomolgus monkey - 97%

Alternative gene names: SNAP43

Alternative protein names: snRNA-activating protein complex subunit 1; SNAPc subunit 1; Proximal sequence element-binding transcription factor subunit gamma; PSE-binding factor subunit gamma; PTF subunit gamma; Small nuclear RNA-activating complex polypeptide 1; snRNA-activating protein complex 43 kDa subunit; SNAPc 43 kDa subunit

Protein name: small nuclear RNA activating complex polypeptide 1

Full length: 368 amino acids

Entry name: SNPC1_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-10431-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-10431-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 6617