Recombinant Human SNCG Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O76070

Gene Name: SNCG

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 94%

Start Site: Ala11

End Site: Glu120

Coverage: 0.97

Isoelectric Point: 6

Core Sequence: AKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 94%, Rat - 89%, Pig - 90%, Cynomolgus monkey - 96%

Alternative gene names: BCSG1; PERSYN; PRSN

Alternative protein names: Gamma-synuclein; Breast cancer-specific gene 1 protein; Persyn; Synoretin; SR

Protein name: synuclein gamma

Full length: 127 amino acids

Entry name: SYUG_HUMAN

• Artikelnummer: ASBPP-037-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-037-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 6623