Recombinant Human SORCS3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9UPU3

Gene Name: SORCS3

Expression System: Escherichia coli

Molecular Weight: 16 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 61%

Start Site: Gly41

End Site: Asp180

Coverage: 0.12

Isoelectric Point: 12

Core Sequence: GGPGRPAAPASRPPALSPLSPRAVASQWPEELASARRAAVLGRRAGPELLPQQGGGRGGEMQVEAGGTSPAGERRGRGIPAPAKLGGARRSRRAQPPITQERGDAWATAPADGSRGSRPLAKGSREEVKAPRAGGSAAED

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 61%, Pig - 69%, Cynomolgus monkey - 94%

Alternative gene names: KIAA1059

Alternative protein names: VPS10 domain-containing receptor SorCS3

Protein name: sortilin related VPS10 domain containing receptor 3

Full length: 1222 amino acids

Entry name: SORC3_HUMAN

• Artikelnummer: ASBPP-3058-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3058-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 22986