Recombinant Human TACC3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y6A5

Gene Name: TACC3

Expression System: Escherichia coli

Molecular Weight: 26.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 64%

Start Site: Val11

End Site: His230

Coverage: 0.28

Isoelectric Point: 5

Core Sequence: VSNEKNTENCDFLFSPPEVTGRSSVLRVSQKENVPPKNLAKAMKVTFQTPLRDPQTHRILSPSMASKLEAPFTQDDTLGLENSHPVWTQKENQQLIKEVDAKTTHGILQKPVEADTDLLGDASPAFGSGSSSESGPGALADLDCSSSSQSPGSSENQMVSPGKVSGSPEQAVEENLSSYSLDRRVTPASETLEDPCRTESQHKAETPHGAEEECKAETPH

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 64%, Pig - 50%, Cynomolgus monkey - 89%

Alternative gene names: ERIC1

Alternative protein names: Transforming acidic coiled-coil-containing protein 3; ERIC-1

Protein name: transforming acidic coiled-coil containing protein 3

Full length: 838 amino acids

Entry name: TACC3_HUMAN

• Artikelnummer: ASBPP-1041-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-1041-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 10460