Recombinant Human TATDN3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q17R31

Gene Name: TATDN3

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 87%

Start Site: Asp21

End Site: Leu130

Coverage: 0.41

Isoelectric Point: 5

Core Sequence: DRDLDDVLEKAKKANVVALVAVAEHSGEFEKIMQLSERYNGFVLPCLGVHPVQGLPPEDQRSVTLKDLDVALPIIENYKDRLLAIGEVGLDFSPRFAGTGEQKEEQRQVL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 87%, Pig - 89%, Cynomolgus monkey - 98%

Alternative gene names: /

Alternative protein names: Putative deoxyribonuclease TATDN3

Protein name: TatD DNase domain containing 3

Full length: 274 amino acids

Entry name: TATD3_HUMAN

Product panel: Enzyme

• Artikelnummer: ASBPP-3647-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3647-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 128387