Recombinant Human TCF19 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y242

Gene Name: TCF19

Expression System: Escherichia coli

Molecular Weight: 12.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 60%

Start Site: Ser181

End Site: Gly270

Coverage: 0.29

Isoelectric Point: 11.5

Core Sequence: SLSKLRPQPLTFSPSWGGPKSLPVPAPPGEMGTTPSAPPQRNRRKSVHRVLAELDDESEPPENPPPVLMEPRKKLRVDKAPLTPTGNRRG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 60%, Pig - 75%, Cynomolgus monkey - 92%

Alternative gene names: SC1

Alternative protein names: Transcription factor 19; TCF-19; Transcription factor SC1

Protein name: transcription factor 19

Full length: 345 amino acids

Entry name: TCF19_HUMAN

• Artikelnummer: ASBPP-3333-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3333-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 6941