Recombinant Human TERB2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8NHR7

Gene Name: TERB2

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 67%

Start Site: Ile101

End Site: Asn170

Coverage: 0.38

Isoelectric Point: 7.5

Core Sequence: IGSFIWEQDQHFLIEKHDEVTPNEIKTLRENSELATEHKKELSKSPEKHFIRTPVVEKQMYFPLQNYPVN

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 67%

Alternative gene names: C15orf43

Alternative protein names: Telomere repeats-binding bouquet formation protein 2

Protein name: telomere repeat binding bouquet formation protein 2

Full length: 220 amino acids

Entry name: TERB2_HUMAN

• Artikelnummer: ASBPP-3307-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3307-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 145645